Циклін D1

CCND1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

2W96, 2W99, 2W9F, 2W9Z

Ідентифікатори
Символи CCND1, BCL1, D11S287E, PRAD1, U21B31, cyclin D1
Зовнішні ІД OMIM: 168461 MGI: 88313 HomoloGene: 1334 GeneCards: CCND1
Пов'язані генетичні захворювання
мієломна хвороба[1]
Реагує на сполуку
palbociclib[2]
Онтологія гена
Молекулярна функція

protein kinase activity
GO:0001106 transcription corepressor activity
transcription factor binding
histone deacetylase binding
kinase activity
cyclin-dependent protein serine/threonine kinase regulator activity
GO:0001948, GO:0016582 protein binding
enzyme binding
proline-rich region binding
protein kinase binding
cyclin-dependent protein serine/threonine kinase activity
GO:0032403 protein-containing complex binding

Клітинна компонента

цитоплазма
гіалоплазма
cyclin-dependent protein kinase holoenzyme complex
мембрана
bicellular tight junction
transcription repressor complex
внутрішньоклітинний
нуклеоплазма
клітинне ядро

Біологічний процес

cellular response to organic substance
mammary gland epithelial cell proliferation
positive regulation of mammary gland epithelial cell proliferation
response to estradiol
positive regulation of protein phosphorylation
Leydig cell differentiation
GO:0009373 regulation of transcription, DNA-templated
GO:1904578 response to organic cyclic compound
response to steroid hormone
response to corticosterone
negative regulation of Wnt signaling pathway
response to magnesium ion
response to glucocorticoid
re-entry into mitotic cell cycle
GO:1901227 negative regulation of transcription by RNA polymerase II
Wnt signaling pathway
mammary gland alveolus development
response to organic substance
transcription, DNA-templated
response to vitamin E
regulation of cell cycle
response to iron ion
response to estrogen
response to calcium ion
поділ клітини
cellular response to DNA damage stimulus
Відповідь на незгорнуті білки
protein phosphorylation
regulation of G1/S transition of mitotic cell cycle
liver regeneration
mitotic G1 DNA damage checkpoint signaling
animal organ regeneration
response to organonitrogen compound
positive regulation of cell population proliferation
positive regulation of cyclin-dependent protein serine/threonine kinase activity
canonical Wnt signaling pathway
response to UV-A
клітинний цикл
liver development
positive regulation of G2/M transition of mitotic cell cycle
лактація
response to ethanol
response to leptin
negative regulation of epithelial cell differentiation
fat cell differentiation
response to X-ray
positive regulation of cell cycle
transcription initiation from RNA polymerase II promoter
G1/S transition of mitotic cell cycle
cytokine-mediated signaling pathway
positive regulation of epithelial cell proliferation
regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0007067 мітоз
regulation of mitotic nuclear division
positive regulation of G1/S transition of mitotic cell cycle

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
595
12443
Ensembl
ENSG00000110092
ENSMUSG00000070348
UniProt
P24385
P25322
RefSeq (мРНК)
NM_053056
NM_007631
NM_001379248
RefSeq (білок)
NP_444284
NP_031657
NP_001366177
Локус (UCSC) Хр. 11: 69.64 – 69.65 Mb Хр. 7: 144.48 – 144.49 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CCND1 (англ. Cyclin D1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 295 амінокислот, а молекулярна маса — 33 729[6].

Послідовність амінокислот
1020304050
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQK
EVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQ
LLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKW
NLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPP
SMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQ
IEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, поділ клітини, пошкодження ДНК. Локалізований у цитоплазмі, ядрі, мембрані.

Література

  • Lew D.J., Dulic V., Reed S.I. (1991). Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast. Cell. 66: 1197—1206. PMID 1833066 DOI:10.1016/0092-8674(91)90042-W
  • Xiong Y., Connolly T., Futcher B., Beach D. (1991). Human D-type cyclin. Cell. 65: 691—699. PMID 1827756 DOI:10.1016/0092-8674(91)90100-D
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Motokura T., Arnold A. (1993). The PRAD1/cyclin D1 proto-oncogene: genomic organization, 5' DNA sequence, and sequence of a tumor-specific rearrangement breakpoint. Genes Chromosomes Cancer. 7: 89—95. PMID 7687458 DOI:10.1002/gcc.2870070205
  • Germain D., Russell A., Thompson A., Hendley J. (2000). Ubiquitination of free cyclin D1 is independent of phosphorylation on threonine 286. J. Biol. Chem. 275: 12074—12079. PMID 10766840 DOI:10.1074/jbc.275.16.12074
  • Liu W.D., Wang H.W., Muguira M., Breslin M.B., Lan M.S. (2006). INSM1 functions as a transcriptional repressor of the neuroD/beta2 gene through the recruitment of cyclin D1 and histone deacetylases. Biochem. J. 397: 169—177. PMID 16569215 DOI:10.1042/BJ20051669

Примітки

  1. Захворювання, генетично пов'язані з CCND1 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Cyclin D1 переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:1582 (англ.) . Процитовано 8 вересня 2017.
  6. UniProt, P24385 (англ.) . Процитовано 8 вересня 2017.

Див. також

  • Хромосома 11
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

 
Фактори транскрипції та внутрішньоклітинні рецептори
 
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
 
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
 
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
 
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
 
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші