XBP1

XBP1
Ідентифікатори
Символи XBP1, TREB5, XBP-1, XBP2, TREB-5, X-box binding protein 1
Зовнішні ІД OMIM: 194355 MGI: 98970 HomoloGene: 3722 GeneCards: XBP1
Пов'язані генетичні захворювання
esophagus squamous cell carcinoma[1]
Онтологія гена
Молекулярна функція

estrogen receptor binding
protein homodimerization activity
protease binding
GO:0001948, GO:0016582 protein binding
protein kinase binding
sequence-specific DNA binding
GO:0001158 cis-regulatory region sequence-specific DNA binding
protein heterodimerization activity
chromatin DNA binding
ubiquitin protein ligase binding
DNA binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
identical protein binding

Клітинна компонента

гіалоплазма
мембрана
integral component of membrane
нуклеоплазма
integral component of endoplasmic reticulum membrane
endoplasmic reticulum membrane
цитоплазма
ендоплазматичний ретикулум
клітинне ядро

Біологічний процес

positive regulation of MHC class II biosynthetic process
positive regulation of protein phosphorylation
negative regulation of endoplasmic reticulum unfolded protein response
positive regulation of immunoglobulin production
muscle organ development
vascular endothelial growth factor receptor signaling pathway
phosphatidylinositol 3-kinase signaling
GO:0097285 апоптоз
GO:0009373 regulation of transcription, DNA-templated
regulation of protein stability
glucose homeostasis
transcription, DNA-templated
cell growth
positive regulation of endothelial cell apoptotic process
response to unfolded protein
fatty acid biosynthetic process
protein transport
positive regulation of TOR signaling
exocrine pancreas development
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
диференціація клітин
positive regulation of autophagy
cellular response to laminar fluid shear stress
positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
positive regulation of B cell differentiation
GO:1901227 negative regulation of transcription by RNA polymerase II
cellular response to fluid shear stress
organelle organization
regulation of autophagy
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
positive regulation of proteasomal protein catabolic process
positive regulation of plasma cell differentiation
positive regulation of T cell differentiation
positive regulation of endoplasmic reticulum unfolded protein response
positive regulation of histone methylation
lipid metabolism
epithelial cell maturation involved in salivary gland development
positive regulation of protein acetylation
positive regulation of ER-associated ubiquitin-dependent protein catabolic process
автофагія
multicellular organism development
ATF6-mediated unfolded protein response
IRE1-mediated unfolded protein response
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
epithelial cell maturation
cellular response to oxidative stress
cellular response to vascular endothelial growth factor stimulus
protein destabilization
cellular response to peptide hormone stimulus
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of pathway-restricted SMAD protein phosphorylation
adipose tissue development
positive regulation of vascular associated smooth muscle cell migration
liver development
cellular triglyceride homeostasis
cholesterol homeostasis
negative regulation of transforming growth factor beta receptor signaling pathway
positive regulation of lactation
cellular response to amino acid stimulus
Ангіогенез
cellular response to glucose starvation
response to insulin-like growth factor stimulus
negative regulation of ERK1 and ERK2 cascade
fatty acid homeostasis
positive regulation of vascular associated smooth muscle cell proliferation
positive regulation of hepatocyte proliferation
sterol homeostasis
cellular response to interleukin-4
positive regulation of protein kinase B signaling
ubiquitin-dependent protein catabolic process
positive regulation of fat cell differentiation
negative regulation of apoptotic process
endothelial cell proliferation
transcription by RNA polymerase II
positive regulation of cell population proliferation
negative regulation of myotube differentiation
positive regulation of cell migration
Відповідь на незгорнуті білки
cellular response to nutrient
cellular response to insulin stimulus
response to endoplasmic reticulum stress
positive regulation of vascular wound healing
positive regulation of angiogenesis
neuron development
cellular response to lipopolysaccharide
cellular response to fructose stimulus
cellular response to glucose stimulus
positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
cellular response to leukemia inhibitory factor
positive regulation of protein import into nucleus
regulation of cell growth

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
7494
22433
Ensembl
ENSG00000100219
ENSMUSG00000020484
UniProt
P17861
O35426
RefSeq (мРНК)
NM_005080
NM_001079539
NM_001393999
NM_001394000
NM_001271730
NM_013842
RefSeq (білок)
NP_001073007
NP_005071
NP_001258659
NP_038870
Локус (UCSC) Хр. 22: 28.79 – 28.8 Mb Хр. 11: 5.47 – 5.48 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

XBP1 (англ. X-box binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 261 амінокислот, а молекулярна маса — 28 695[5].

Послідовність амінокислот
1020304050
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEA
ASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQ
QVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEA
KGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQS
LISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWG
RHQPSWKPLMN

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, відповідь на стрес, транскрипція, регуляція транскрипції, метаболізм ліпідів, транспорт, транспорт білків, відповідь на порушення конформації білку, ангіогенез, автофагія, біосинтез ліпідів, диференціація клітин, міогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі, мембрані, ендоплазматичному ретикулумі.

Література

  • Yoshida H., Matsui T., Yamamoto A., Okada T., Mori K. (2001). XBP1 mRNA is induced by ATF6 and spliced by IRE1 in response to ER stress to produce a highly active transcription factor. Cell. 107: 881—891. PMID 11779464 DOI:10.1016/S0092-8674(01)00611-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ono S.J., Liou H.C., Davidon R., Strominger J.L., Glimcher L.H. (1991). Human X-box-binding protein 1 is required for the transcription of a subset of human class II major histocompatibility genes and forms a heterodimer with c-fos. Proc. Natl. Acad. Sci. U.S.A. 88: 4309—4312. PMID 1903538 DOI:10.1073/pnas.88.10.4309
  • Clauss I.M., Chu M., Zhao J.-L., Glimcher L.H. (1996). The basic domain/leucine zipper protein hXBP-1 preferentially binds to and transactivates CRE-like sequences containing an ACGT core. Nucleic Acids Res. 24: 1855—1864. PMID 8657566 DOI:10.1093/nar/24.10.1855
  • Sriburi R., Jackowski S., Mori K., Brewer J.W. (2004). XBP1: a link between the unfolded protein response, lipid biosynthesis, and biogenesis of the endoplasmic reticulum. J. Cell Biol. 167: 35—41. PMID 15466483 DOI:10.1083/jcb.200406136
  • Yoshida H., Nadanaka S., Sato R., Mori K. (2006). XBP1 is critical to protect cells from endoplasmic reticulum stress: evidence from Site-2 protease-deficient Chinese hamster ovary cells. Cell Struct. Funct. 31: 117—125. PMID 17110785 DOI:10.1247/csf.06016

Примітки

  1. Захворювання, генетично пов'язані з XBP1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:12801 (англ.) . Архів оригіналу за 27 серпня 2017. Процитовано 12 вересня 2017.
  5. UniProt, P17861 (англ.) . Архів оригіналу за 26 вересня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 22
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

 
Фактори транскрипції та внутрішньоклітинні рецептори
 
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
 
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
 
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
 
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
 
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші